Trifluoroacetic Acid
Trifluoroacetic acid is a corrosive organofluorine compound that is structurally analogous to, but stronger than, acetic acid. Available in various quantities and reagent grades, it is used in NMR spectroscopy, mass spectrometry, organic synthesis, etc.
Almost 100,000-fold more acidic than acetic acid, TFA is widely used in organic chemistry. TFA is used as a reagent in organic synthesis because of its properties: volatility, organic solvent solubility, and acidic strength. It is less oxidizing than sulfuric acid and is more readily available in its anhydrous form than some other acids . Other features include:
- Used in acid-catalyzed reactions, especially peptide synthesis (to cleave esters)
- Dissolves protein when mixed with liquid SO2
- Removes t-butyl derived side-chain protecting groups in Fmoc peptide synthesis
- Can remove the t-butoxycarbonyl protecting group in organic synthesis
- At low concentrations, acts as an ion-pairing agent for peptides and small proteins in organic compound liquid chromatography
- For acid-stable materials, can be a solvent for NMR spectroscopy
- Acts as a calibrant in mass spectrometry
- Used to produce trifluoroacetate salts
- An ingredient in adhesives, sealants, paints, and coatings
When TFA combines with bases and metals, especially light metals, a strong exothermic reaction occurs. When mixed with lithium aluminum hydride (LAH), the reaction is explosive.
Although nonflammable, TFA is corrosive to skin, eyes, and mucous membranes and requires careful use and handling. It is harmful when inhaled, causes severe skin burns and eye damage, and is toxic to aquatic organisms at even low concentrations.
TFA is also a product of the metabolic breakdown of the anesthetic agent halothane. It is the suspected cause of halothane-induced hepatitis.
Medchemexpress LLC GRGDSP TFA | 98.0% | 701.61 | 25 MG
GRGDSP (TFA) is an integrin inhibitor. This synthetic linear RGD peptide can inhibit the adherence of tumor cells to endothelial cells of blood vessels, thereby limiting metastasis. It is also utilized to modify the surface of cardiovascular implants, such as vascular grafts, to promote endothelialization, and is widely employed in integrin research as a soluble integrin-blocking RGD-based peptide.
- Inhibits adherence of tumor cells to endothelial cells of blood vessels
- Limits metastasis
- Promotes endothelialization for cardiovascular implants
- Used in integrin research
- Functions as a soluble integrin-blocking RGD-based peptide
Medchemexpress LLC TAT peptide TFA | 99.8% | 1735.93 | 25 MG
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1. It has been studied in functionalized hybrid nanoparticles for magnetic enrichment and optical detection in cell separation and rapid cell labelling, demonstrating good biocompatibility.
- Derived from trans-activating transcriptional activator (Tat) from HIV-1
- Cell penetrating peptide (GRKKRRQRRRPQ)
- Used in functionalized hybrid nanoparticles for cell separation
- Used in rapid cell labelling
- Shows good biocompatibility
- For research use only
Medchemexpress LLC PKA RII peptide TFA | 99.7% | 2226.37 | 10 MG
PKA RII peptide TFA is a PKA substrate that, after being phosphorylated at the serine residue, can be used for the detection of calcineurin activity. It is for research use only.
- Solid appearance, white to off-white color.
- Sequence: Asp-Leu-Asp-Val-Pro-Ile-Pro-Gly-Arg-Phe-Asp-Arg-R-Val-Ser-Val-Ala-Ala-Glu.
- Sequence shortening: DLDVPIPGRFDRRVSVAAE.
- Store as powder at -80°C for 2 years or -20°C for 1 year.
- Store in solvent at -80°C for 6 months or -20°C for 1 month (sealed storage, away from moisture).
- Soluble in H2O at 25 mg/mL (11.23 mM, requires ultrasonic).
Medchemexpress LLC RSM3 TFA | 98.83% | 3049.66 | 5 MG
RSM3 TFA, a stapled peptide, is a METTL3-METTL14 inhibitor with a Kd of 3.10 μM. It inhibits tumor growth and induces cell apoptosis. RSM3 TFA can be used for the study of cancer.
- Inhibits tumor growth
- Induces cell apoptosis
- Used for the study of cancer
- Stapled peptide
- METTL3-METTL14 inhibitor
Medchemexpress LLC SAR441255 (TFA) | 99.9% | 4866.56 | 25 MG
SAR441255 TFA is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. It displays high potency with balanced activation of all three target receptors and shows positive acute glucoregulatory effects in diabetic obese monkeys.
- Potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist.
- Displays high potency with balanced activation of all three target receptors.
- Shows positive acute glucoregulatory effects in diabetic obese monkeys.
Medchemexpress LLC Veldoreotide TFA | 2126831-23-8 | 99.0% | 1237.33 | 1 MG
Veldoreotide (DG3173) TFA is a somatostatin analogue that binds to and activates somatostatin receptors (SSTR) 2, 4, and 5. It inhibits growth hormone (GH) secretion in adenomas and shows potential as a pain modulating agent. This product is for research use only.
- Binds to and activates SSTR 2, 4, and 5
- Inhibits growth hormone (GH) secretion
- Potential pain modulating agent
- Purity: 98.97%
- Appearance: White to off-white solid
- Soluble in H2O at 25 mg/mL (requires ultrasonic)
Medchemexpress LLC NN1177 (TFA) | 98.7% | 4570.07 (free base) | 25 MG
NN1177 TFA is a long-acting GLP-1/glucagon receptor co-agonist. It induces dose-dependent body weight loss in diet-induced obese mice. This product is for research use only.
- Long-acting GLP-1/glucagon receptor co-agonist
- Induces dose-dependent body weight loss in diet-induced obese mice
- Reduces CYP3A4 mRNA expression and activity in human hepatocytes
- Improves glucose tolerance in diet-induced obese mice
- Reduces liver fat and inflammatory biomarkers in NASH model mice
Medchemexpress LLC Thymocartin TFA 5mg | 5MG
Thymocartin TFA is the TFA salt form of Thymocartin (HY-105025) Thymocartin TFA inhibits apoptosis of peripheral blood lymphocytes in HIV infected individuals Thymocartin TFA is potential for immunodeficiency diseases research[1 [2
Medchemexpress LLC Dendrotoxin-I TFA | 99.9% | 7149.24 | 500 UG
Dendrotoxin-I TFA is a potent K+ channel blocker effective against voltage-gated potassium channel subunits KV1.1, KV1.2, and KV1.6, with IC50s ranging from 0.13-50 nM. This neurotoxin holds potential in cancer research, as demonstrated by its significant tumor growth inhibition effect when combined with hyperthermia in nude mice with MCF-7 cells.
- Potent K+ channel blocker
- Effective against voltage-gated potassium channel subunits KV1.1, KV1.2, and KV1.6
- Exhibits neurotoxic properties
- Potential for use in cancer research
- Demonstrated tumor growth inhibition in in vivo studies
Medchemexpress LLC DOTA-ADIBO TFA | 1374865-01-6 | 99.1% | 776.76 g/mol | C36H43F3N6O10 | 5 MG
DOTA-ADIBO TFA is a DOTA-derived bifunctional chelator supplied as the trifluoroacetic acid salt. It enables biomolecule conjugation via strain-promoted, copper-free azide-alkyne cycloaddition and supports construction of fusion chelator systems for radiometal labeling and PET radiotracer synthesis. The compound is provided as a high-purity solid with DMSO solubility and requires protected, low-temperature storage.
- DOTA-derived bifunctional chelator for copper-free click conjugation.
- Facilitates radiometal labeling for PET radiotracer synthesis.
- High reported purity suitable for research applications.
- Soluble in DMSO (≈100 mg/mL); may require sonication.
- Store under nitrogen, protect from light, keep at low temperatures.
- Provided as a TFA salt to aid handling and stability.
![Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000386801-logo.png-250.jpg){kind=logo}
Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG
OncoACP3 TFA from MedChemExpress is a small-molecule ligand of prostatic acid phosphatase (ACP3). This product is applicable to research related to prostate cancer.
- Molecular formula: C62H82F3N12O15P
- Molecular weight: 1323.35
- Appearance: White to off-white solid
- Storage: Powder at -20°C for 3 years; in solvent at -80°C for 6 months, or -20°C for 1 month
- Purity (LCMS): 99.87%
Medchemexpress LLC G-Pen-GRGDSPCA (TFA) | 98.8% | 948.04 | 5 MG
G-Pen-GRGDSPCA (TFA) is a solid, white to off-white chemical product primarily identified for use as a laboratory chemical and in the manufacture of substances. It demonstrates stability under recommended storage conditions.
- Appearance: white to off-white solid
- Chemical stability: stable under recommended storage conditions
- Identified uses: laboratory chemicals, manufacture of substances
- Purity: 98.76% (LCMS)
- Consistent with structure (LCMS)
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways
Medchemexpress LLC OS-2966 1mg | 1mg
OS-2966 is a humanized antibody expressed in CHO cells targeting Integrin b1/ITGB1/CD29 OS-2966 carries a huIgG1 type heavy chain and a hu type light chain with a predicted molecular weight (MW) of 145 5 kDa The isotype control for OS-2966 can be referenced as Human IgG1 kappa Isotype Control (HY-P99001)
Medchemexpress LLC Pgk13a TFA | 96.9% | 2004.73 (free base) | 5 MG
pGk13a TFA is an azide-containing amphiphilic membrane labeling probe. It enables high-resolution imaging of cell membranes in the ultrastructural membrane expansion microscopy (umExM) technique, facilitating the observation of membrane-associated structures and proteins. It can be used for neuronal structural studies.
- Azide-containing amphiphilic membrane labeling probe
- Enables high-resolution imaging of cell membranes
- Used in ultrastructural membrane expansion microscopy (umExM)
- Facilitates observation of membrane-associated structures and proteins
- Applicable for neuronal structural studies